Received: from malur.postgresql.org ([217.196.149.56]) by arkaria.postgresql.org with esmtps (TLS1.3) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.96) (envelope-from ) id 1w30Wj-000oMT-23 for pgsql-bugs@arkaria.postgresql.org; Wed, 18 Mar 2026 23:42:13 +0000 Received: from localhost ([127.0.0.1] helo=malur.postgresql.org) by malur.postgresql.org with esmtp (Exim 4.96) (envelope-from ) id 1w30Wi-00FWdN-0B for pgsql-bugs@arkaria.postgresql.org; Wed, 18 Mar 2026 23:42:12 +0000 Received: from makus.postgresql.org ([2001:4800:3e1:1::229]) by malur.postgresql.org with esmtps (TLS1.3) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.96) (envelope-from ) id 1w30Wh-00FWdF-1w for pgsql-bugs@lists.postgresql.org; Wed, 18 Mar 2026 23:42:11 +0000 Received: from relay7-d.mail.gandi.net ([2001:4b98:dc4:8::227]) by makus.postgresql.org with esmtps (TLS1.3) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.98.2) (envelope-from ) id 1w30Wd-00000000RiW-2oOH for pgsql-bugs@lists.postgresql.org; Wed, 18 Mar 2026 23:42:10 +0000 Received: by mail.gandi.net (Postfix) with ESMTPSA id A63903E95C; Wed, 18 Mar 2026 23:42:04 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=vondra.me; s=gm1; t=1773877325; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=Sa1TELRAG6TjSlXHns6wjmshqX7kZ8NTl2Is+/V2utk=; b=eh03TOEE1PxWkjJ5n052HrLxIPfYKglvH0vN/2FUVCXKNKn107LEy2BV+dx6y8yejP8hgD BRt9UCBfC76thJiUltmoPRKu4SigrPbyLLr1IoDJeh9IKCTGndOFj5l4g+GkUXviz9J/2N dHc1tu6rAfVU3ymXYl0nNSUc8A71HFJIBLmyhdBUQ8q51E2VATeZ1lN7TgGuFCUyO5fHnX YfQvuX0w8kfCmL+9J4/68MY1dxGGCJkWEQS6arJEe4WuSSCleNh78NVEiVhgKypZ2wWnNn 9kNWTn1uD3je4t1shfVzd0DEWLDk82chCYJvQRLKhkCg/mvYjOrbecm4LxymPw== Message-ID: <883b7a3c-84ac-4825-a73e-6772c81bc1e1@vondra.me> Date: Thu, 19 Mar 2026 00:42:03 +0100 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Segmentation fault in PostgreSQL 17.7 during REINDEX TABLE CONCURRENTLY To: Ana Almeida , Jim Jones , "pgsql-bugs@lists.postgresql.org" Cc: Nuno Azevedo References: <941c71e4-3b46-4eab-a5de-b59511ab1018@uni-muenster.de> Content-Language: en-US From: Tomas Vondra In-Reply-To: Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-GND-Sasl: tomas@vondra.me X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdeftdehgeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefkffggfgfuvfevfhfhjggtgfesthekredttddvjeenucfhrhhomhepvfhomhgrshcugghonhgurhgruceothhomhgrshesvhhonhgurhgrrdhmvgeqnecuggftrfgrthhtvghrnhepuedvvdeifefffeekudeggfdtieeglefggeduheffveeihefggfehgfdvudetffevnecukfhppeekiedrgeelrddvfedtrddvtdeinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepkeeirdegledrvdeftddrvddtiedphhgvlhhopegluddtrddufeejrddtrddvngdpmhgrihhlfhhrohhmpehtohhmrghssehvohhnughrrgdrmhgvpdhqihgupeetieefledtfefgleehvedpmhhouggvpehsmhhtphhouhhtpdhnsggprhgtphhtthhopeegpdhrtghpthhtoheptehnrgdrtehlmhgvihgurgesthhimhgvshhtrghmphdrphhtpdhrtghpthhtohepjhhimhdrjhhonhgvshesuhhnihdqmhhuvghnshhtvghrrdguvgdprhgtphhtthhopehpghhsqhhlqdgsuhhgsheslhhishhtshdrphhoshhtghhrvghsqhhlrdhorhhgpdhrtghpthhtoheppfhunhhordetiigvvhgvughosehtihhmvghsthgrmhhprdhpth X-GND-State: clean List-Id: List-Help: List-Subscribe: List-Post: List-Owner: List-Archive: Archived-At: Precedence: bulk On 3/18/26 15:54, Ana Almeida wrote: > Hello Jim, > > I didn’t notice that the error showed the schema and table name. For > confidentiality reasons, could you please not share the schema and table > name if this is released as a bug? > > Here is the information: > >   > >                                                          Table > "myschema.mytable" > >        Column       |            Type             | Collation | Nullable > | Default | Storage  | Compression | Stats target | Description > > --------------------+-----------------------------+----------- > +----------+---------+----------+-------------+--------------+------------- > > id                 | bigint                      |           | not null > |         | plain    |             |              | > > axxxxxx            | character varying(32)       |           | not null > |         | extended |             |              | > > bxx                | text                        |           | not null > |         | extended |             |              | > > cxxxxxxx           | text                        |           | not null > |         | extended |             |              | > > dxxxxxxxx          | text                        |           |          > |         | extended |             |              | > > lag_val            | text                        |           |          > |         | extended |             |              | > > exxxxxxxxxx        | text                        |           |          > |         | extended |             |              | > > fxxxxxxxxxxxxx     | text                        |           |          > |         | extended |             |              | > > gxxxxxxxxxxxx      | text                        |           |          > |         | extended |             |              | > > hxxxxxx            | numeric                     |           | not null > |         | main     |             |              | > > ixxxxxxxxxxxxxx    | numeric                     |           |          > |         | main     |             |              | > > jxxxxxxxxxxxxxx    | numeric                     |           |          > |         | main     |             |              | > > kxxxxxx            | integer                     |           |          > |         | plain    |             |              | > > lxxxxxxxxxxxx      | integer                     |           | not null > |         | plain    |             |              | > > mxxxxxxxxxxxxxx    | timestamp without time zone |           |          > |         | plain    |             |              | > > nxxxxxxxxxxxxx     | timestamp without time zone |           |          > |         | plain    |             |              | > > oxxxxxxxxxxxx      | timestamp without time zone |           |          > |         | plain    |             |              | > > pxxxxxxxxxxx       | timestamp without time zone |           | not null > |         | plain    |             |              | > > qr_mydb_id         | bigint                      |           |          > |         | plain    |             |              | > > qxxxxxx            | character varying(100)      |           |          > |         | extended |             |              | > > Indexes: > >     "mytable_pkey" PRIMARY KEY, btree (id) > >     "idx_lag_val" btree (lag_val) > >     "idx_mytable_qr_mydb" btree (qr_mydb_id) > > Foreign-key constraints: > >     "fk__mytable__qr_mydb" FOREIGN KEY (qr_mydb_id) REFERENCES > myschema.qr_mydb(id) > > Access method: heap > > Options: autovacuum_enabled=true, toast.autovacuum_enabled=true > >   > > Just another note, before we also had the error below in the same > reindex command. The database didn’t crash when that error happened but > the reindex failed. After that, we recreated the table. > >   > > ERROR:  could not open file "base/179146/184526.4" (target block > 808464432): previous segment is only 99572 blocks > So what was the sequence of events, exactly? You got this "could not open file" error during REINDEX CONCURRENTLY, you recreated the table and then it crashed on some later REINDEX CONCURRENTLY? How did you recreate the table? Did you reload it from a backup or something else? > > We haven’t been able to reproduce the errors again. > That suggests it might have been some sort of data corruption, but it's just a guess. Have you checked the server log if there are any messages suggesting e.g. storage / memory issues or something like that? Per the backtrace you shared in the previous message, the segfault happened here: #0 0x00000000005d67a8 validate_index_callback (postgres) #1 0x00000000005738bd btvacuumpage (postgres) #2 0x0000000000573d8a btvacuumscan (postgres) #3 0x0000000000573f00 btbulkdelete (postgres) ... Which is a very heavily exercised code, so I'm somewhat skeptical a bug would go unnoticed for very long. It's possible, of course. But the validate_index_callback doesn't do all that much - it just writes the TID value to a tuplesort / temporary file. It seems you have the core saved in a file: > Storage: /var/lib/systemd/coredump/core.postgres.26.0a32... Can you try inspecting getting a better backtrace using gdb? It might tell us if there's a bogus pointer or something like that. Or maybe not, chances are the compiler optimized some of the variables, but it's worth a try. regards -- Tomas Vondra