Received: from malur.postgresql.org ([217.196.149.56]) by arkaria.postgresql.org with esmtps (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from ) id 1jKzrz-000716-KX for pgsql-hackers@arkaria.postgresql.org; Sun, 05 Apr 2020 07:39:03 +0000 Received: from localhost ([127.0.0.1] helo=malur.postgresql.org) by malur.postgresql.org with esmtp (Exim 4.92) (envelope-from ) id 1jKzrS-0004RL-Te for pgsql-hackers@arkaria.postgresql.org; Sun, 05 Apr 2020 07:38:30 +0000 Received: from makus.postgresql.org ([2001:4800:3e1:1::229]) by malur.postgresql.org with esmtps (TLS1.3:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from ) id 1jKzrS-0004RD-Mg for pgsql-hackers@lists.postgresql.org; Sun, 05 Apr 2020 07:38:30 +0000 Received: from courriel-2.mines-paristech.fr ([77.158.173.19] helo=antispam-1.ensmp.fr) by makus.postgresql.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.92) (envelope-from ) id 1jKzrL-0005um-Kf for pgsql-hackers@postgresql.org; Sun, 05 Apr 2020 07:38:29 +0000 Received: from smtp-4.mines-paristech.fr (smtp-4.ensmp.fr [77.158.173.143]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by antispam-1.ensmp.fr (antispam.mines-paristech.fr) with ESMTPS id 1A60055E93; Sun, 5 Apr 2020 09:38:20 +0200 (CEST) Received: from pseudo (108.237.219.88.rev.sfr.net [88.219.237.108]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp-4.mines-paristech.fr (Postfix) with ESMTPSA id 8BC432C0191; Sun, 5 Apr 2020 09:38:19 +0200 (CEST) Date: Sun, 5 Apr 2020 09:38:17 +0200 (CEST) From: Fabien COELHO X-X-Sender: fabien@pseudo To: Corey Huinker cc: Justin Pryzby , Alvaro Herrera , Erik Rijkers , =?ISO-8859-15?Q?J=FCrgen_Purtz?= , Roger Harkavy , pgsql-hackers@postgresql.org, Michael Paquier Subject: Re: Add A Glossary In-Reply-To: Message-ID: References: <7b9b469e804777ac9df4d37716db935e@xs4all.nl> <20200403205143.GA7961@alvherre.pgsql> <20200403210120.GA12283@telsasoft.com> User-Agent: Alpine 2.21 (DEB 202 2017-01-01) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed X-CLAMAV-SCAN: ok X-VRSPAM-SCORE: -100 X-VRSPAM-STATE: legit X-VRSPAM-CAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedruddtgddviecutefuodetggdotefrucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepfffhvffujgfkfhgfgggtsehttdertddtredvnecuhfhrohhmpefhrggsihgvnhcuvefqgffnjffquceotghovghlhhhosegtrhhirdgvnhhsmhhprdhfrheqnecukfhppeekkedrvdduledrvdefjedruddtkeenucfrrghrrghmpehmohguvgepshhmthhpohhuth X-VRSPAM-EXTCAUSE: mhhouggvpehsmhhtphhouhht List-Id: List-Help: List-Subscribe: List-Post: List-Owner: List-Archive: Precedence: bulk Hi Corey, >> ISTM that occurrences of these words elsewhere in the documentation should >> link to the glossary definitions? > > Yes, that's a big project. I was considering writing a script to compile > all the terms as search terms, paired with their glossary ids, and then > invoke git grep to identify all pages that have term FOO but don't have > glossary-foo. We would then go about gloss-linking those pages as > appropriate, but only a few pages at a time to keep scope sane. Id go for scripting the thing. Should the glossary be backpatched, to possibly ease doc patchpatches? > Also, I'm unclear about the circumstances under which we should _not_ > tag a term. At least when then are explained locally. > I remember hearing that we should only tag it on the first usage, but is > that per section or per page? Page? >> As the definitions are short and to the point, maybe the HTML display >> could (also) "hover" the definitions when the mouse passes over the word, >> using the "title" attribute? > > I like that idea, if it doesn't conflict with accessibility standards > (maybe that's just titles on images, not sure). The following worked fine: Title Tag Test The ACID property is great. So basically the def can be put on the glossary link, however retrieving the definition should be automatic. > I suspect we would want to just carry over the first sentence or so with a > ... to avoid cluttering the screen with my overblown definition of a > sequence. Dunno. The definitions are quite short, maybe the can fit whole. > I suggest we pursue this idea in another thread, as we'd probably want to > do it for acronyms as well. Or not. I'd test committer temperature before investing time because it would mean that backpatching the doc would be a little harder. >> Entries could link to relevant wikipedia pages, like the acronyms section >> does? > > They could. I opted not to do that because each external link invites > debate about how authoritative that link is, which is easier to do with > acronyms. Now that the glossary is a reality, it's easier to have those > discussions. Ok. -- Fabien.